| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanin-concentrating hormone receptor 1 |
|---|
| Ligand | BDBM50191768 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_403902 (CHEMBL909733) |
|---|
| Ki | 91±n/a nM |
|---|
| Citation |  Warshakoon, NC; Sheville, J; Bhatt, RT; Ji, W; Mendez-Andino, JL; Meyers, KM; Kim, N; Wos, JA; Mitchell, C; Paris, JL; Pinney, BB; Reizes, O; Hu, XE Design and synthesis of substituted quinolines as novel and selective melanin concentrating hormone antagonists as anti-obesity agents. Bioorg Med Chem Lett16:5207-11 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanin-concentrating hormone receptor 1 |
|---|
| Name: | Melanin-concentrating hormone receptor 1 |
|---|
| Synonyms: | G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | MCHR1 | MCHR1_HUMAN | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | SLC1 | Somatostatin receptor-like protein |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 45976.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays. |
|---|
| Residue: | 422 |
|---|
| Sequence: | MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
|
|
|
|---|
| BDBM50191768 |
|---|
| n/a |
|---|
| Name | BDBM50191768 |
|---|
| Synonyms: | 6-(4-chlorophenyl)-3-((3-(pyrrolidin-1-ylmethyl)quinolin-8-yl)methyl)thieno[3,2-d]pyrimidin-4(3H)-one | CHEMBL384156 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H23ClN4OS |
|---|
| Mol. Mass. | 487.016 |
|---|
| SMILES | Clc1ccc(cc1)-c1cc2ncn(Cc3cccc4cc(CN5CCCC5)cnc34)c(=O)c2s1 |
|---|
| Structure | 
|
|---|
Search and Browse
