Reaction Details |
| Report a problem with these data |
Target | tRNA (guanine-N(1)-)-methyltransferase |
---|
Ligand | BDBM50613266 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2291656 |
---|
IC50 | 11±n/a nM |
---|
Citation | Wilkinson, AJ; Ooi, N; Finlayson, J; Lee, VE; Lyth, D; Maskew, KS; Newman, R; Orr, D; Ansell, K; Birchall, K; Canning, P; Coombs, P; Fusani, L; McIver, E; Pisco, J; Ireland, PM; Jenkins, C; Norville, IH; Southern, SJ; Cowan, R; Hall, G; Kettleborough, C; Savage, VJ; Cooper, IR Evaluating the druggability of TrmD, a potential antibacterial target, through design and microbiological profiling of a series of potent TrmD inhibitors. Bioorg Med Chem Lett90:0 (2023) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
tRNA (guanine-N(1)-)-methyltransferase |
---|
Name: | tRNA (guanine-N(1)-)-methyltransferase |
Synonyms: | 2.1.1.228 | M1G-methyltransferase | tRNA (guanine-N(1)-)-methyltransferase | tRNA [GM37] methyltransferase | trmD |
Type: | PROTEIN |
Mol. Mass.: | 28417.50 |
Organism: | Escherichia coli (strain K12) |
Description: | ChEMBL_120942 |
Residue: | 255 |
Sequence: | MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIQSWSPRDFTHDRHRTVDDRPYGGGPGM
LMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGIDE
RVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVLGHEASATEDSFAEGLLDCPH
YTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQARLLAEF
KTEHAQQQHKHDGMA
|
|
|
BDBM50613266 |
---|
n/a |
---|
Name | BDBM50613266 |
Synonyms: | CHEMBL5268562 |
Type | Small organic molecule |
Emp. Form. | C19H23N5O |
Mol. Mass. | 337.4188 |
SMILES | NC(=O)c1ccc(NC2(CC2)c2cccc(c2)N2CCNCC2)nc1 |
Structure |
|