Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50608624 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2294250 |
---|
Ki | 13±n/a nM |
---|
Citation | Ghosh, AK; Shahabi, D; Kipfmiller, M; Ghosh, AK; Johnson, M; Wang, YF; Agniswamy, J; Amano, M; Weber, IT; Mitsuya, H Evaluation of darunavir-derived HIV-1 protease inhibitors incorporating P2' amide-derivatives: Synthesis, biological evaluation and structural studies. Bioorg Med Chem Lett83:0 (2023) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50608624 |
---|
n/a |
---|
Name | BDBM50608624 |
Synonyms: | CHEMBL5274743 |
Type | Small organic molecule |
Emp. Form. | C28H36N2O9S |
Mol. Mass. | 576.658 |
SMILES | [H][C@@]12CCO[C@]1([H])OC[C@@H]2OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(cc1)C(O)=O |r| |
Structure |
|