Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50229594 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_460138 (CHEMBL924980) |
---|
Ki | 0.68±n/a nM |
---|
Citation | Briard, E; Zoghbi, SS; Imaizumi, M; Gourley, JP; Shetty, HU; Hong, J; Cropley, V; Fujita, M; Innis, RB; Pike, VW Synthesis and evaluation in monkey of two sensitive 11C-labeled aryloxyanilide ligands for imaging brain peripheral benzodiazepine receptors in vivo. J Med Chem51:17-30 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50229594 |
---|
n/a |
---|
Name | BDBM50229594 |
Synonyms: | CHEMBL253597 | N-(2-methoxybenzyl)-N-(4-phenoxypyridin-3-yl)acetamide |
Type | Small organic molecule |
Emp. Form. | C21H20N2O3 |
Mol. Mass. | 348.3951 |
SMILES | COc1ccccc1CN(C(C)=O)c1cnccc1Oc1ccccc1 |
Structure |
|