Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50266025 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_540201 (CHEMBL1029830) |
---|
Ki | 0.031±n/a nM |
---|
Citation | Ballet, S; Feytens, D; Wachter, RD; Vlaeminck, MD; Marczak, ED; Salvadori, S; Graaf, C; Rognan, D; Negri, L; Lattanzi, R; Lazarus, LH; Tourwé, D; Balboni, G Conformationally constrained opioid ligands: the Dmt-Aba and Dmt-Aia versus Dmt-Tic scaffold. Bioorg Med Chem Lett19:433-7 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40465.04 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
Residue: | 372 |
Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50266025 |
---|
n/a |
---|
Name | BDBM50266025 |
Synonyms: | (S)-2-((S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanoyl)-N-(2-(benzylamino)-2-oxoethyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide | 2-[2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid (benzylcarbamoyl-methyl)-amide | CHEMBL458631 | H-Dmt-Tic-Gly-NH-Bzl | H-Dmt-Tic-Gly-NH-CH2-Ph |
Type | Small organic molecule |
Emp. Form. | C30H34N4O4 |
Mol. Mass. | 514.6154 |
SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2C[C@H]1C(=O)NCC(=O)NCc1ccccc1 |r| |
Structure |
|