Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 4 |
---|
Ligand | BDBM50267400 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_563013 (CHEMBL1016197) |
---|
IC50 | 20±n/a nM |
---|
Citation | Tsou, HR; Liu, X; Birnberg, G; Kaplan, J; Otteng, M; Tran, T; Kutterer, K; Tang, Z; Suayan, R; Zask, A; Ravi, M; Bretz, A; Grillo, M; McGinnis, JP; Rabindran, SK; Ayral-Kaloustian, S; Mansour, TS Discovery of 4-(benzylaminomethylene)isoquinoline-1,3-(2H,4H)-diones and 4-[(pyridylmethyl)aminomethylene]isoquinoline-1,3-(2H,4H)-diones as potent and selective inhibitors of the cyclin-dependent kinase 4. J Med Chem52:2289-310 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 4 |
---|
Name: | Cyclin-dependent kinase 4 |
Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
Type: | Enzyme Subunit |
Mol. Mass.: | 33731.96 |
Organism: | Homo sapiens (Human) |
Description: | P11802 |
Residue: | 303 |
Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
BDBM50267400 |
---|
n/a |
---|
Name | BDBM50267400 |
Synonyms: | (4Z)-4-{[(3-Hydroxy-4-propoxybenzyl)amino]methylene}-6-iodoisoquinoline-1,3(2H,4H)-dione | CHEMBL477861 |
Type | Small organic molecule |
Emp. Form. | C20H19IN2O4 |
Mol. Mass. | 478.2803 |
SMILES | CCCOc1ccc(CNC=C2C(=O)NC(=O)c3ccc(I)cc23)cc1O |w:10.9| |
Structure |
|