| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cysteinyl leukotriene receptor 1 |
|---|
| Ligand | BDBM50284897 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_98639 |
|---|
| IC50 | 13±n/a nM |
|---|
| Citation |  Lau, CK; Dufresne, C; Gareau, Y; Zamboni, R; Labelle, M; Young, RN; Metters, KM; Rochette, C; Sawyer, N; Slipetz, DM; Charette, L; Jones, T; McAuliffe, M; McFarlane, C; Ford-Hutchinson, AW Evolution of a series of non-quinoline leukotriene D4 receptor antagonist; synthesis and sar of benzothiazoles and thiazoles substituted benzyl alcohols as potent LTD4 antagonists Bioorg Med Chem Lett5:1615-1620 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cysteinyl leukotriene receptor 1 |
|---|
| Name: | Cysteinyl leukotriene receptor 1 |
|---|
| Synonyms: | CLTR1_CAVPO | CYSLTR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39007.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | Leukotriene D4 0 GUINEA PIG::Q2NNR5 |
|---|
| Residue: | 340 |
|---|
| Sequence: | MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
|
|
|
|---|
| BDBM50284897 |
|---|
| n/a |
|---|
| Name | BDBM50284897 |
|---|
| Synonyms: | CHEMBL40992 | [1-((R)-3-[2-(1-Hydroxy-1-methyl-ethyl)-phenyl]-1-{3-[(E)-2-(4-isopropyl-5-methyl-thiazol-2-yl)-vinyl]-phenyl}-propylsulfanylmethyl)-cyclopropyl]-acetic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H41NO3S2 |
|---|
| Mol. Mass. | 563.814 |
|---|
| SMILES | CC(C)c1nc(\C=C\c2cccc(c2)[C@@H](CCc2ccccc2C(C)(C)O)SCC2(CC(O)=O)CC2)sc1C |
|---|
| Structure | 
|
|---|
Search and Browse
