Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50289952 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_63794 (CHEMBL679047) |
---|
IC50 | 3200±n/a nM |
---|
Citation | Abood, NA; Schretzman, LA; Flynn, DL; Houseman, KA; Wittwer, AJ; Dilworth, VM; Hippenmeyer, PJ; Holwerda, BC Inhibition of human cytomegalovirus protease by benzoxazinones and evidence of antiviral activity in cell culture Bioorg Med Chem Lett7:2105-2108 (1997) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50289952 |
---|
n/a |
---|
Name | BDBM50289952 |
Synonyms: | 6-Dimethylamino-5-methyl-2-(1-phenyl-ethylamino)-benzo[d][1,3]oxazin-4-one | CHEMBL294771 |
Type | Small organic molecule |
Emp. Form. | C19H21N3O2 |
Mol. Mass. | 323.3889 |
SMILES | C[C@@H](Nc1nc2ccc(N(C)C)c(C)c2c(=O)o1)c1ccccc1 |
Structure |
|