| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-8 |
|---|
| Ligand | BDBM50295279 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_577736 (CHEMBL1052371) |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Sablone, MR; Cesta, MC; Moriconi, A; Aramini, A; Bizzarri, C; Di Giacinto, C; Di Bitondo, R; Gloaguen, I; Aschi, M; Crucianelli, M; Bertini, R; Allegretti, M Structure-Activity Relationship of novel phenylacetic CXCR1 inhibitors. Bioorg Med Chem Lett19:4026-30 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-8 |
|---|
| Name: | Interleukin-8 |
|---|
| Synonyms: | CXCL8 | IL8 | IL8_HUMAN | MDNCF-a | interleukin 8 precursor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11104.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_577736 |
|---|
| Residue: | 99 |
|---|
| Sequence: | MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
|
|
|
|---|
| BDBM50295279 |
|---|
| n/a |
|---|
| Name | BDBM50295279 |
|---|
| Synonyms: | 2-(2-(2,6-difluorophenylamino)phenyl)acetic acid | CHEMBL260968 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11F2NO2 |
|---|
| Mol. Mass. | 263.2394 |
|---|
| SMILES | OC(=O)Cc1ccccc1Nc1c(F)cccc1F |
|---|
| Structure | 
|
|---|
Search and Browse
