Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Interleukin-8 |
---|
Ligand | BDBM50295279 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_577736 (CHEMBL1052371) |
---|
IC50 | >1000±n/a nM |
---|
Citation | Sablone, MR; Cesta, MC; Moriconi, A; Aramini, A; Bizzarri, C; Di Giacinto, C; Di Bitondo, R; Gloaguen, I; Aschi, M; Crucianelli, M; Bertini, R; Allegretti, M Structure-Activity Relationship of novel phenylacetic CXCR1 inhibitors. Bioorg Med Chem Lett19:4026-30 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-8 |
---|
Name: | Interleukin-8 |
Synonyms: | CXCL8 | IL8 | IL8_HUMAN | MDNCF-a | interleukin 8 precursor |
Type: | PROTEIN |
Mol. Mass.: | 11104.05 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_577736 |
Residue: | 99 |
Sequence: | MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
|
|
|
BDBM50295279 |
---|
n/a |
---|
Name | BDBM50295279 |
Synonyms: | 2-(2-(2,6-difluorophenylamino)phenyl)acetic acid | CHEMBL260968 |
Type | Small organic molecule |
Emp. Form. | C14H11F2NO2 |
Mol. Mass. | 263.2394 |
SMILES | OC(=O)Cc1ccccc1Nc1c(F)cccc1F |
Structure |
|