Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50310076 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_612206 (CHEMBL1074144) |
---|
Ki | 4.41±n/a nM |
---|
Citation | Rossi, D; Urbano, M; Pedrali, A; Serra, M; Zampieri, D; Mamolo, MG; Laggner, C; Zanette, C; Florio, C; Schepmann, D; Wuensch, B; Azzolina, O; Collina, S Design, synthesis and SAR analysis of novel selective sigma1 ligands (Part 2). Bioorg Med Chem18:1204-12 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50310076 |
---|
n/a |
---|
Name | BDBM50310076 |
Synonyms: | (E)-1-(3-(6-Methoxynaphthalen-2-yl)but-2-enyl)piperidine | CHEMBL597023 |
Type | Small organic molecule |
Emp. Form. | C20H25NO |
Mol. Mass. | 295.4186 |
SMILES | COc1ccc2cc(ccc2c1)C(\C)=C\CN1CCCCC1 |
Structure |
|