| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50198065 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_612206 (CHEMBL1074144) |
|---|
| Ki | 4.17±n/a nM |
|---|
| Citation |  Rossi, D; Urbano, M; Pedrali, A; Serra, M; Zampieri, D; Mamolo, MG; Laggner, C; Zanette, C; Florio, C; Schepmann, D; Wuensch, B; Azzolina, O; Collina, S Design, synthesis and SAR analysis of novel selective sigma1 ligands (Part 2). Bioorg Med Chem18:1204-12 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50198065 |
|---|
| n/a |
|---|
| Name | BDBM50198065 |
|---|
| Synonyms: | 4(E)-N-Benzyl-3-(biphenyl-4-yl)-N-methylbut-2-en-1-amine | CHEMBL1917697 | CHEMBL224099 | benzyl-((E)-3-biphenyl-4-yl-but-2-enyl)-methyl-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H25N |
|---|
| Mol. Mass. | 327.462 |
|---|
| SMILES | CN(C\C=C(/C)c1ccc(cc1)-c1ccccc1)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
