| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Baculoviral IAP repeat-containing protein 7 |
|---|
| Ligand | BDBM50314456 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_624591 (CHEMBL1111551) |
|---|
| Ki | 120000±n/a nM |
|---|
| Citation |  Cohen, F; Koehler, MF; Bergeron, P; Elliott, LO; Flygare, JA; Franklin, MC; Gazzard, L; Keteltas, SF; Lau, K; Ly, CQ; Tsui, V; Fairbrother, WJ Antagonists of inhibitor of apoptosis proteins based on thiazole amide isosteres. Bioorg Med Chem Lett20:2229-33 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Baculoviral IAP repeat-containing protein 7 |
|---|
| Name: | Baculoviral IAP repeat-containing protein 7 |
|---|
| Synonyms: | BIR3 | BIRC7 | BIRC7_HUMAN | Baculoviral IAP repeat-containing protein 7 | KIAP | LIVIN | MLIAP | RNF50 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32792.04 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_624591 |
|---|
| Residue: | 298 |
|---|
| Sequence: | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVE
AQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
|
|
|
|---|
| BDBM50314456 |
|---|
| n/a |
|---|
| Name | BDBM50314456 |
|---|
| Synonyms: | (S)-N-((S)-1-((S)-2-(4-(benzo[b]thiophen-3-yl)thiazol-2-yl)pyrrolidin-1-yl)-3,3-dimethyl-1-oxobutan-2-yl)-2-(methylamino)propanamide | CHEMBL1090866 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H32N4O2S2 |
|---|
| Mol. Mass. | 484.677 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@H](C(=O)N1CCC[C@H]1c1nc(cs1)-c1csc2ccccc12)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
