Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50329776 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_674756 (CHEMBL1274064) |
---|
Ki | 13.2±n/a nM |
---|
Citation | Kovac, M; Mavel, S; Deuther-Conrad, W; Méheux, N; Glöckner, J; Wenzel, B; Anderluh, M; Brust, P; Guilloteau, D; Emond, P 3D QSAR study, synthesis, and in vitro evaluation of (+)-5-FBVM as potential PET radioligand for the vesicular acetylcholine transporter (VAChT). Bioorg Med Chem18:7659-67 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50329776 |
---|
n/a |
---|
Name | BDBM50329776 |
Synonyms: | (rac)-5-Fluoro-3-(4-phenyl-piperidin-1-yl)-1,2,3,4-tetrahydro-naphthalen-2-ol | CHEMBL1271906 |
Type | Small organic molecule |
Emp. Form. | C21H24FNO |
Mol. Mass. | 325.4198 |
SMILES | OC1Cc2cccc(F)c2CC1N1CCC(CC1)c1ccccc1 |
Structure |
|