| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 14 |
|---|
| Ligand | BDBM50341346 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_747874 (CHEMBL1781129) |
|---|
| Kd | 1.2±n/a nM |
|---|
| Citation |  Soth, M; Abbot, S; Abubakari, A; Arora, N; Arzeno, H; Billedeau, R; Dewdney, N; Durkin, K; Frauchiger, S; Ghate, M; Goldstein, DM; Hill, RJ; Kuglstatter, A; Li, F; Loe, B; McCaleb, K; McIntosh, J; Papp, E; Park, J; Stahl, M; Sung, ML; Suttman, R; Swinney, DC; Weller, P; Wong, B; Zecic, H; Gabriel, T 3-Amino-pyrazolo[3,4-d]pyrimidines as p38a kinase inhibitors: design and development to a highly selective lead. Bioorg Med Chem Lett21:3452-6 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 14 |
|---|
| Name: | Mitogen-activated protein kinase 14 |
|---|
| Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 41286.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q16539 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
|---|
| BDBM50341346 |
|---|
| n/a |
|---|
| Name | BDBM50341346 |
|---|
| Synonyms: | (R)-6-(2,4-difluorophenoxy)-8-methyl-2-(1-(methylsulfonyl)propan-2-ylamino)pyrido[2,3-d]pyrimidin-7(8H)-one | 6-(2,4-Difluorophenoxy)-2-((R)-2-methanesulfonyl-1-methyl-ethylamino)-8-methyl-8H-pyrido[2,3-d]pyrimidin-7-one | 6-(2,4-difluorophenoxy)-8-methyl-2-{[(1R)-1-methyl-2-(methylsulfonyl)ethyl]amino}pyrido[2,3-d]pyrimidin-7(8H)-one | CHEMBL1232769 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18F2N4O4S |
|---|
| Mol. Mass. | 424.422 |
|---|
| SMILES | C[C@H](CS(C)(=O)=O)Nc1ncc2cc(Oc3ccc(F)cc3F)c(=O)n(C)c2n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
