| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thromboxane A2 receptor |
|---|
| Ligand | BDBM50344163 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_748142 (CHEMBL1781821) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Zaghdane, H; Boyd, M; Colucci, J; Simard, D; Berthelette, C; Leblanc, Y; Wang, Z; Houle, R; Lévesque, JF; Molinaro, C; Hamel, M; Stocco, R; Sawyer, N; Sillaots, S; Gervais, F; Gallant, M New indole amide derivatives as potent CRTH2 receptor antagonists. Bioorg Med Chem Lett21:3471-4 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thromboxane A2 receptor |
|---|
| Name: | Thromboxane A2 receptor |
|---|
| Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
|---|
| Type: | Enyzme |
|---|
| Mol. Mass.: | 37445.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21731 |
|---|
| Residue: | 343 |
|---|
| Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
|---|
| BDBM50344163 |
|---|
| n/a |
|---|
| Name | BDBM50344163 |
|---|
| Synonyms: | (R)-2-(7-(2-(4-fluorophenyl)-N-methylacetamido)-6,7,8,9-tetrahydropyrido[1,2-a]indol-10-yl)acetic acid | CHEMBL1778506 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23FN2O3 |
|---|
| Mol. Mass. | 394.4387 |
|---|
| SMILES | CN([C@@H]1CCc2c(CC(O)=O)c3ccccc3n2C1)C(=O)Cc1ccc(F)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
