Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bis(5'-adenosyl)-triphosphatase |
---|
Ligand | BDBM50350516 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_762663 (CHEMBL1817387) |
---|
Ki | 35±n/a nM |
---|
Citation | Krakowiak, A; Pecherzewska, R; Kaczmarek, R; Tomaszewska, A; Nawrot, B; Stec, WJ Evaluation of influence of Ap4A analogues on Fhit-positive HEK293T cells; cytotoxicity and ability to induce apoptosis. Bioorg Med Chem19:5053-60 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bis(5'-adenosyl)-triphosphatase |
---|
Name: | Bis(5'-adenosyl)-triphosphatase |
Synonyms: | AP3A hydrolase | AP3Aase | Bis(5'adenosyl)-triphosphatase | Dinucleosidetriphosphatase | FHIT | FHIT_HUMAN | Fragile histidine triad protein |
Type: | Protein |
Mol. Mass.: | 16861.00 |
Organism: | Homo sapiens (Human) |
Description: | P49789 |
Residue: | 147 |
Sequence: | MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
DKEDFPASWRSEEEMAAEAAALRVYFQ
|
|
|
BDBM50350516 |
---|
n/a |
---|
Name | BDBM50350516 |
Synonyms: | CHEMBL1812066 |
Type | Small organic molecule |
Emp. Form. | C23H32N10O13P2S2 |
Mol. Mass. | 782.637 |
SMILES | Nc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(S)(=O)OCC(O)COP(S)(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)[C@@H](O)[C@H]1O |r| |
Structure |
|