Reaction Details |
| Report a problem with these data |
Target | HTH-type transcriptional regulator EthR |
---|
Ligand | BDBM50363024 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_800731 (CHEMBL1947974) |
---|
EC50 | 10000±n/a nM |
---|
Citation | Flipo, M; Desroses, M; Lecat-Guillet, N; Villemagne, B; Blondiaux, N; Leroux, F; Piveteau, C; Mathys, V; Flament, MP; Siepmann, J; Villeret, V; Wohlkönig, A; Wintjens, R; Soror, SH; Christophe, T; Jeon, HK; Locht, C; Brodin, P; Déprez, B; Baulard, AR; Willand, N Ethionamide boosters. 2. Combining bioisosteric replacement and structure-based drug design to solve pharmacokinetic issues in a series of potent 1,2,4-oxadiazole EthR inhibitors. J Med Chem55:68-83 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
HTH-type transcriptional regulator EthR |
---|
Name: | HTH-type transcriptional regulator EthR |
Synonyms: | ETHR_MYCTU | HTH-type transcriptional regulator EthR | Transcriptional repressor EthR (EthR) | etaR | ethR |
Type: | Protein |
Mol. Mass.: | 23751.94 |
Organism: | Mycobacterium tuberculosis |
Description: | P9WMC1 |
Residue: | 216 |
Sequence: | MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPT
FYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAV
TRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNE
RTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR
|
|
|
BDBM50363024 |
---|
n/a |
---|
Name | BDBM50363024 |
Synonyms: | CHEMBL1945819 |
Type | Small organic molecule |
Emp. Form. | C17H17F4N3O2 |
Mol. Mass. | 371.3294 |
SMILES | Fc1ccccc1-c1noc(n1)C1CCN(CC1)C(=O)CCC(F)(F)F |
Structure |
|