| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight protein-tyrosine phosphatase A |
|---|
| Ligand | BDBM50363150 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_801146 (CHEMBL1948973) |
|---|
| IC50 | 174000±n/a nM |
|---|
| Citation |  Chiaradia, LD; Martins, PG; Cordeiro, MN; Guido, RV; Ecco, G; Andricopulo, AD; Yunes, RA; Vernal, J; Nunes, RJ; Terenzi, H Synthesis, biological evaluation, and molecular modeling of chalcone derivatives as potent inhibitors of Mycobacterium tuberculosis protein tyrosine phosphatases (PtpA and PtpB). J Med Chem55:390-402 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight protein-tyrosine phosphatase A |
|---|
| Name: | Low molecular weight protein-tyrosine phosphatase A |
|---|
| Synonyms: | PTPA_MYCTU | PTPase | Probable low molecular weight protein-tyrosine-phosphatase | Protein Tyrosine Phosphatase PTPA | mptpA | ptpA |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 17891.84 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | n/a |
|---|
| Residue: | 163 |
|---|
| Sequence: | MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAG
VLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTH
ALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
|
|
|
|---|
| BDBM50363150 |
|---|
| n/a |
|---|
| Name | BDBM50363150 |
|---|
| Synonyms: | CHEMBL1946986 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H12ClF3O4 |
|---|
| Mol. Mass. | 420.766 |
|---|
| SMILES | FC(F)(F)c1ccc(Cl)c(c1)-c1ccc(\C=C\C(=O)c2ccc3OCOc3c2)o1 |
|---|
| Structure | 
|
|---|
Search and Browse
