Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50366262 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201273 (CHEMBL804962) |
---|
Ki | 2±n/a nM |
---|
Citation | Prucher, H; Gottschlich, R; Haase, A; Stohrer, M; Seyfried, C (5S)-3-aryl-5-(1-piperidinylmethyl)-2-oxazolidinones, a new class of potential neuroleptics with a high affinity for sigma receptors Bioorg Med Chem Lett2:165-170 (1992) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50366262 |
---|
n/a |
---|
Name | BDBM50366262 |
Synonyms: | CHEMBL417353 |
Type | Small organic molecule |
Emp. Form. | C26H30N2O6 |
Mol. Mass. | 466.5262 |
SMILES | OC1(CCN(C[C@H]2CN(C(=O)O2)c2ccc(OCC3CC3)cc2)CC1)c1ccc2OCOc2c1 |
Structure |
|