Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50080947 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_149641 |
---|
IC50 | 6600±n/a nM |
---|
Citation | Pevarello, P; Bonsignori, A; Caccia, C; Amici, R; McArthur, RA; Fariello, RG; Salvati, P; Varasi, M Sodium channel activity and sigma binding of 2-aminopropanamide anticonvulsants. Bioorg Med Chem Lett9:2521-4 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50080947 |
---|
n/a |
---|
Name | BDBM50080947 |
Synonyms: | (R)-2-[4-(3-Fluoro-benzyloxy)-benzylamino]-3-hydroxy-N-methyl-propionamide | CHEMBL85899 |
Type | Small organic molecule |
Emp. Form. | C18H21FN2O3 |
Mol. Mass. | 332.3693 |
SMILES | CNC(=O)[C@@H](CO)NCc1ccc(OCc2cccc(F)c2)cc1 |
Structure |
|