| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50018707 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_147112 (CHEMBL758275) |
|---|
| IC50 | 21±n/a nM |
|---|
| Citation |  Gacel, G; Zajac, JM; Delay-Goyet, P; Daugé, V; Roques, BP Investigation of the structural parameters involved in the mu and delta opioid receptor discrimination of linear enkephalin-related peptides. J Med Chem31:374-83 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50018707 |
|---|
| n/a |
|---|
| Name | BDBM50018707 |
|---|
| Synonyms: | 2-{2-[2-(2-{2-[2-Amino-3-(4-hydroxy-phenyl)-propionylamino]-3-hydroxy-pentanoylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoylamino}-3-hydroxy-butyric acid | CHEMBL2370601 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H50N6O10 |
|---|
| Mol. Mass. | 714.8057 |
|---|
| SMILES | CC[C@H](O)[C@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
