| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50008681 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159125 |
|---|
| IC50 | 21000±n/a nM |
|---|
| Citation |  Kahn, M; Nakanishi, H; Chrusciel, RA; Fitzpatrick, D; Johnson, ME Examination of HIV-1 protease secondary structure specificity using conformationally constrained inhibitors. J Med Chem34:3395-9 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50008681 |
|---|
| n/a |
|---|
| Name | BDBM50008681 |
|---|
| Synonyms: | 4-{2-[9-(Benzylamino-methyl)-6,10-dioxo-1,4,7,8,9,10-hexahydro-6H-pyridazino[1,2-a][1,2]diazepin-1-yl]-acetylamino}-3-hydroxy-6-methyl-heptanoic acid [1-(1-carbamoyl-2-phenyl-ethylcarbamoyl)-2-methyl-butyl]-amide | CHEMBL325180 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H59N7O7 |
|---|
| Mol. Mass. | 773.9606 |
|---|
| SMILES | CCC(C)[C@H](NC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)CC1C=CCN2N1C(=O)C(CNCc1ccccc1)CCC2=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |c:21| |
|---|
| Structure | 
|
|---|
Search and Browse
