| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM83449 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_226545 (CHEMBL846485) |
|---|
| IC50 | 1000±n/a nM |
|---|
| Citation |  Kimes, AS; Wilson, AA; Scheffel, U; Campbell, BG; London, ED Radiosynthesis, cerebral distribution, and binding of [125I]-1-(p-iodophenyl)-3-(1-adamantyl)guanidine, a ligand for sigma binding sites. J Med Chem35:4683-9 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM83449 |
|---|
| n/a |
|---|
| Name | BDBM83449 |
|---|
| Synonyms: | 1-(1-phenylcyclohexyl)piperidine;hydrochloride | MLS002320664 | PCP | PCP hydrochloride | PHENCYCLIDINE | Phencyclidine hydrochloride | SMR001338811 | cid_9795678 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H25N |
|---|
| Mol. Mass. | 243.3871 |
|---|
| SMILES | C1CCN(CC1)C1(CCCCC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
