Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50041479 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_37642 (CHEMBL650286) |
---|
IC50 | 30±n/a nM |
---|
Citation | Greco, G; Novellino, E; Fiorini, I; Nacci, V; Campiani, G; Ciani, SM; Garofalo, A; Bernasconi, P; Mennini, T A comparative molecular field analysis model for 6-arylpyrrolo[2,1-d] [1,5]benzothiazepines binding selectively to the mitochondrial benzodiazepine receptor. J Med Chem37:4100-8 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50041479 |
---|
n/a |
---|
Name | BDBM50041479 |
Synonyms: | CHEMBL32716 | Propionic acid 5-(4-methoxy-phenyl)-6-thia-10b-aza-benzo[e]azulen-4-yl ester |
Type | Small organic molecule |
Emp. Form. | C22H19NO3S |
Mol. Mass. | 377.456 |
SMILES | CCC(=O)OC1=C(Sc2ccccc2-n2cccc12)c1ccc(OC)cc1 |t:5| |
Structure |
|