| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Ligand | BDBM50034507 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_204738 (CHEMBL805431) |
|---|
| IC50 | 437±n/a nM |
|---|
| Citation |  Li, X; Singh, SM; Côté, J; Laplante, S; Veilleux, R; Labrie, F Synthesis and in vitro evaluation of 4-substituted N-(1,1-dimethylethyl)-3-oxo-4-androstene-17 beta-carboxamides as 5 alpha-reductase inhibitors and antiandrogens. J Med Chem38:1456-61 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 | 5 alpha-SR2 | 5α-Reductase 2 (5α-R2) | S5A2_HUMAN | SR type 2 | SRD5A2 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 2 | Type II 5-alpha reductase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28406.59 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P31213 |
|---|
| Residue: | 254 |
|---|
| Sequence: | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
|
|
|
|---|
| BDBM50034507 |
|---|
| n/a |
|---|
| Name | BDBM50034507 |
|---|
| Synonyms: | (10R,13S,17S)-4-Mercapto-10,13-dimethyl-3-oxo-2,3,6,7,8,9,10,11,12,13,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthrene-17-carboxylic acid tert-butylamide | CHEMBL24464 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H37NO2S |
|---|
| Mol. Mass. | 403.621 |
|---|
| SMILES | CC(C)(C)NC(=O)[C@H]1CCC2C3CCC4C(=S)C(=O)CC[C@]4(C)C3CC[C@]12C |
|---|
| Structure | 
|
|---|
Search and Browse
