Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50054729 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_226554 (CHEMBL847751) |
---|
IC50 | 8.5±n/a nM |
---|
Citation | Matecka, D; Rothman, RB; Radesca, L; de Costa, BR; Dersch, CM; Partilla, JS; Pert, A; Glowa, JR; Wojnicki, FH; Rice, KC Development of novel, potent, and selective dopamine reuptake inhibitors through alteration of the piperazine ring of 1-[2-(diphenylmethoxy)ethyl]-and 1-[2-[bis(4-fluorophenyl)methoxy]ethyl]-4-(3-phenylpropyl)piperazines (GBR 12935 and GBR 12909). J Med Chem39:4704-16 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50054729 |
---|
n/a |
---|
Name | BDBM50054729 |
Synonyms: | (2S,5R)-2,5-Dimethyl-1,4-bis-(3-phenyl-propyl)-piperazine | CHEMBL348432 |
Type | Small organic molecule |
Emp. Form. | C24H34N2 |
Mol. Mass. | 350.5402 |
SMILES | C[C@H]1CN(CCCc2ccccc2)[C@H](C)CN1CCCc1ccccc1 |
Structure |
|