Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50105070 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_226559 (CHEMBL847756) |
---|
IC50 | 328±n/a nM |
---|
Citation | Poulain, R; Horvath, D; Bonnet, B; Eckhoff, C; Chapelain, B; Bodinier, MC; Déprez, B From hit to lead. Analyzing structure-profile relationships. J Med Chem44:3391-401 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50105070 |
---|
n/a |
---|
Name | BDBM50105070 |
Synonyms: | 1-{3-[(6-Chloro-benzo[1,3]dioxol-5-ylmethyl)-amino]-propyl}-1,3-dihydro-benzoimidazol-2-one | CHEMBL114280 |
Type | Small organic molecule |
Emp. Form. | C18H18ClN3O3 |
Mol. Mass. | 359.807 |
SMILES | Clc1cc2OCOc2cc1CNCCCn1c2ccccc2[nH]c1=O |
Structure |
|