Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, adipocyte |
---|
Ligand | BDBM50152850 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_29917 (CHEMBL641280) |
---|
Kd | 83000±n/a nM |
---|
Citation | Cozzini, P; Fornabaio, M; Marabotti, A; Abraham, DJ; Kellogg, GE; Mozzarelli, A Simple, intuitive calculations of free energy of binding for protein-ligand complexes. 1. Models without explicit constrained water. J Med Chem45:2469-83 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, adipocyte |
---|
Name: | Fatty acid-binding protein, adipocyte |
Synonyms: | A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | FABP4 | FABP4_HUMAN | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4 | Fatty acid-binding protein 4 (FABP4) |
Type: | Enzyme |
Mol. Mass.: | 14719.23 |
Organism: | Homo sapiens (Human) |
Description: | P15090 |
Residue: | 132 |
Sequence: | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
|
|
|
BDBM50152850 |
---|
n/a |
---|
Name | BDBM50152850 |
Synonyms: | 1-HEXYLDECANOIC ACID | CHEMBL82293 | Hexadecanoic acid | Hexadecanoic acid anion | Palmitic acid (PA) |
Type | Small organic molecule |
Emp. Form. | C16H32O2 |
Mol. Mass. | 256.4241 |
SMILES | CCCCCCCCCCCCCCCC(O)=O |
Structure |
|