Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Tryptase beta-2 |
---|
Ligand | BDBM50131985 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_210835 (CHEMBL811864) |
---|
Ki | 90±n/a nM |
---|
Citation | Costanzo, MJ; Yabut, SC; Almond, HR; Andrade-Gordon, P; Corcoran, TW; De Garavilla, L; Kauffman, JA; Abraham, WM; Recacha, R; Chattopadhyay, D; Maryanoff, BE Potent, small-molecule inhibitors of human mast cell tryptase. Antiasthmatic action of a dipeptide-based transition-state analogue containing a benzothiazole ketone. J Med Chem46:3865-76 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tryptase beta-2 |
---|
Name: | Tryptase beta-2 |
Synonyms: | TPS2 | TPSB2 | TRYB2_HUMAN | Tryptase | Tryptase II | Tryptase beta-1 | Tryptase-2 |
Type: | PROTEIN |
Mol. Mass.: | 30518.79 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_210702 |
Residue: | 275 |
Sequence: | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
|
|
|
BDBM50131985 |
---|
n/a |
---|
Name | BDBM50131985 |
Synonyms: | 1-Acetyl-4-hydroxy-pyrrolidine-2-carboxylic acid [4-amino-1-(benzothiazole-2-carbonyl)-butyl]-amide; TFA | CHEMBL339764 |
Type | Small organic molecule |
Emp. Form. | C19H24N4O4S |
Mol. Mass. | 404.483 |
SMILES | CC(=O)N1C[C@H](O)C[C@H]1C(=O)NC(CCCN)C(=O)c1nc2ccccc2s1 |
Structure |
|