| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 3 |
|---|
| Ligand | BDBM50157314 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_310465 (CHEMBL825861) |
|---|
| EC50 | 990±n/a nM |
|---|
| Citation |  Palucki, BL; Park, MK; Nargund, RP; Ye, Z; Sebhat, IK; Pollard, PG; Kalyani, RN; Tang, R; Macneil, T; Weinberg, DH; Vongs, A; Rosenblum, CI; Doss, GA; Miller, RR; Stearns, RA; Peng, Q; Tamvakopoulos, C; McGowan, E; Martin, WJ; Metzger, JM; Shepherd, CA; Strack, AM; Macintyre, DE; Van der Ploeg, LH; Patchett, AA Discovery of (2S)-N-[(1R)-2-[4-cyclohexyl-4-[[(1,1-dimethylethyl)amino]carbonyl]-1-piperidinyl]-1-[(4-fluorophenyl)methyl]-2-oxoethyl]-4-methyl-2-piperazinecarboxamide (MB243), a potent and selective melanocortin subtype-4 receptor agonist. Bioorg Med Chem Lett15:171-5 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 3 |
|---|
| Name: | Melanocortin receptor 3 |
|---|
| Synonyms: | MC3-R | MC3R | MC3R_HUMAN | Melanocortin MC3 | Melanocortin receptor (M3 and M4) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36044.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41968 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
|
|
|
|---|
| BDBM50157314 |
|---|
| n/a |
|---|
| Name | BDBM50157314 |
|---|
| Synonyms: | (S)-4-Methyl-piperazine-2-carboxylic acid [(R)-2-(4-tert-butylcarbamoyl-4-cyclohexyl-piperidin-1-yl)-1-(4-fluoro-benzyl)-2-oxo-ethyl]-amide | CHEMBL368876 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H48FN5O3 |
|---|
| Mol. Mass. | 557.7429 |
|---|
| SMILES | CN1CCN[C@@H](C1)C(=O)N[C@H](Cc1ccc(F)cc1)C(=O)N1CCC(CC1)(C1CCCCC1)C(=O)NC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
