| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase |
|---|
| Ligand | BDBM9461 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_361103 (CHEMBL859169) |
|---|
| IC50 | 8000±n/a nM |
|---|
| Citation |  Tasdemir, D; Lack, G; Brun, R; Rüedi, P; Scapozza, L; Perozzo, R Inhibition of Plasmodium falciparum fatty acid biosynthesis: evaluation of FabG, FabZ, and FabI as drug targets for flavonoids. J Med Chem49:3345-53 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase |
|---|
| Name: | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase |
|---|
| Synonyms: | Fatty acid synthase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 26222.50 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | ChEMBL_983601 |
|---|
| Residue: | 230 |
|---|
| Sequence: | MRFLIIHIAVIVLPFVLMIDVKRENSFFLRHSPKRLYKKADYNNMYDKIIKKQQNRIYDV
SSQINQDNINGQNISFNLTFPNYDTSIDIEDIKKILPHRYPFLLVDKVIYMQPNKTIIGL
KQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKSDDSQKNNLFLFAGVDGVRWK
KPVLPGDTLTMQANLISFKSSLGIAKLSGVGYVNGKVVINISEMTFALSK
|
|
|
|---|
| BDBM9461 |
|---|
| n/a |
|---|
| Name | BDBM9461 |
|---|
| Synonyms: | 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one | Biochanin A (2) | Biochanin A (BCA) | Biochanin A, 9 | CHEMBL131921 | cid_5280373 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12O5 |
|---|
| Mol. Mass. | 284.2635 |
|---|
| SMILES | COc1ccc(cc1)-c1coc2cc(O)cc(O)c2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
