| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-1 |
|---|
| Ligand | BDBM50272207 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_510247 (CHEMBL1005625) |
|---|
| IC50 | 5000000±n/a nM |
|---|
| Citation |  Giguère, D; Bonin, MA; Cloutier, P; Patnam, R; St-Pierre, C; Sato, S; Roy, R Synthesis of stable and selective inhibitors of human galectins-1 and -3. Bioorg Med Chem16:7811-23 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-1 |
|---|
| Name: | Galectin-1 |
|---|
| Synonyms: | 14 kDa lectin | Galaptin | HPL | LEG1_HUMAN | LGALS1 | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12 |
|---|
| Type: | beta galactoside-binding protein |
|---|
| Mol. Mass.: | 14713.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09382 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
|
|
|
|---|
| BDBM50272207 |
|---|
| n/a |
|---|
| Name | BDBM50272207 |
|---|
| Synonyms: | (2S,3R,4R,5R,6R)-2-((12S,14R,15R,16R,17R,E)-3-((E)-3-((2S,3R,4R,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)-tetrahydro-2H-pyran-2-yl)prop-1-enyl)cinnamyl)-6-(hydroxymethyl)-tetrahydro-2H-pyran-3,4,5-triol | CHEMBL501196 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H34O10 |
|---|
| Mol. Mass. | 482.5208 |
|---|
| SMILES | OC[C@H]1O[C@@H](C\C=C\c2cccc(\C=C\C[C@@H]3O[C@H](CO)[C@H](O)[C@H](O)[C@H]3O)c2)[C@H](O)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
