| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Outer membrane protein MIP |
|---|
| Ligand | BDBM50335224 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_701873 (CHEMBL1657165) |
|---|
| IC50 | 9000±n/a nM |
|---|
| Citation |  Juli, C; Sippel, M; Jäger, J; Thiele, A; Weiwad, M; Schweimer, K; Rösch, P; Steinert, M; Sotriffer, CA; Holzgrabe, U Pipecolic acid derivatives as small-molecule inhibitors of the Legionella MIP protein. J Med Chem54:277-83 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Outer membrane protein MIP |
|---|
| Name: | Outer membrane protein MIP |
|---|
| Synonyms: | MIP_LEGPN | Macrophage infectivity potentiator | PPIase | Peptidyl-prolyl cis-trans isomerase | Rotamase | mip |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24869.94 |
|---|
| Organism: | Legionella pneumophila |
|---|
| Description: | ChEMBL_701873 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MKMKLVTAAVMGLAMSTAMAATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAK
GMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPG
VVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIP
GWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
|
|
|
|---|
| BDBM50335224 |
|---|
| n/a |
|---|
| Name | BDBM50335224 |
|---|
| Synonyms: | CHEMBL1650946 | rac-3-(3,4,5-trimethoxyphenyl)propyl 1-(benzylsulfonyl)piperidine-2-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H33NO7S |
|---|
| Mol. Mass. | 491.597 |
|---|
| SMILES | COc1cc(CCCOC(=O)C2CCCCN2S(=O)(=O)Cc2ccccc2)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
