Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50335221 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_701874 (CHEMBL1657166) |
---|
IC50 | 2800±n/a nM |
---|
Citation | Juli, C; Sippel, M; Jäger, J; Thiele, A; Weiwad, M; Schweimer, K; Rösch, P; Steinert, M; Sotriffer, CA; Holzgrabe, U Pipecolic acid derivatives as small-molecule inhibitors of the Legionella MIP protein. J Med Chem54:277-83 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50335221 |
---|
n/a |
---|
Name | BDBM50335221 |
Synonyms: | CHEMBL1650805 | ethyl 1-(3-nitrophenylsulfonyl)piperidine-2-carboxylate |
Type | Small organic molecule |
Emp. Form. | C14H18N2O6S |
Mol. Mass. | 342.368 |
SMILES | CCOC(=O)C1CCCCN1S(=O)(=O)c1cccc(c1)[N+]([O-])=O |
Structure |
|