Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50342042 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_743741 (CHEMBL1767555) |
---|
Ki | 132±n/a nM |
---|
Citation | Donohue, SR; Dannals, RF; Halldin, C; Pike, VW N-(4-cyanotetrahydro-2H-pyran-4-yl) and N-(1-cyanocyclohexyl) derivatives of 1,5-diarylpyrazole-3-carboxamides showing high affinity for 18 kDa translocator protein and/or cannabinoid receptors. J Med Chem54:2961-70 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50342042 |
---|
n/a |
---|
Name | BDBM50342042 |
Synonyms: | CHEMBL1765682 | N-(4-Cyanotetrahydro-2H-pyran-4-yl)-1-(2-fluorophenyl)-5-(4-methoxyphenyl)-4-methyl-1H-pyrazole-3-carboxamide |
Type | Small organic molecule |
Emp. Form. | C24H23FN4O3 |
Mol. Mass. | 434.4628 |
SMILES | COc1ccc(cc1)-c1c(C)c(nn1-c1ccccc1F)C(=O)NC1(CCOCC1)C#N |
Structure |
|