Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50295421 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_812735 (CHEMBL2019953) |
---|
Ki | 22.5±n/a nM |
---|
Citation | Laurini, E; Col, VD; Mamolo, MG; Zampieri, D; Posocco, P; Fermeglia, M; Vio, L; Pricl, S Homology Model and Docking-Based Virtual Screening for Ligands of the s1 Receptor. ACS Med Chem Lett2:834-839 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50295421 |
---|
n/a |
---|
Name | BDBM50295421 |
Synonyms: | CHEMBL557297 | N,1-Dibenzylpiperidine-4-carboxamide |
Type | Small organic molecule |
Emp. Form. | C20H24N2O |
Mol. Mass. | 308.4174 |
SMILES | O=C(NCc1ccccc1)C1CCN(Cc2ccccc2)CC1 |
Structure |
|