| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50394747 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_859392 (CHEMBL2167298) |
|---|
| IC50 | 15600±n/a nM |
|---|
| Citation |  Wu, Y; He, C; Gao, Y; He, S; Liu, Y; Lai, L Dynamic modeling of human 5-lipoxygenase-inhibitor interactions helps to discover novel inhibitors. J Med Chem55:2597-605 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50394747 |
|---|
| n/a |
|---|
| Name | BDBM50394747 |
|---|
| Synonyms: | CHEMBL2163381 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11N3O4S |
|---|
| Mol. Mass. | 317.32 |
|---|
| SMILES | Cc1cccc(c1)N=C1NS(=O)(=O)c2cc(ccc12)[N+]([O-])=O |w:7.7| |
|---|
| Structure | 
|
|---|
Search and Browse
