| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50399053 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_878773 (CHEMBL2183713) |
|---|
| Ki | 5500±n/a nM |
|---|
| Citation |  Dahlgren, MK; Garcia, AB; Hare, AA; Tirado-Rives, J; Leng, L; Bucala, R; Jorgensen, WL Virtual screening and optimization yield low-nanomolar inhibitors of the tautomerase activity of Plasmodium falciparum macrophage migration inhibitory factor. J Med Chem55:10148-59 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | Macrophage migration inhibitory factor (MIF) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12844.38 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | Q6Q3H7 |
|---|
| Residue: | 116 |
|---|
| Sequence: | MPCCEVITNVNLPDDNVQSTLSQIENAISDVMGKPLGYIMSNYDYQKNLRFGGSNEAYCF
VRITSIGGINRSNNSALADQITKLLVSNLNVKSRRIYVEFRDCSAQNFAFSGSLFG
|
|
|
|---|
| BDBM50399053 |
|---|
| n/a |
|---|
| Name | BDBM50399053 |
|---|
| Synonyms: | CHEMBL2178852 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16N2O2 |
|---|
| Mol. Mass. | 292.3318 |
|---|
| SMILES | COc1cccc(Oc2cc(C)nc(n2)-c2ccccc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
