| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 5A |
|---|
| Ligand | BDBM50399616 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_878520 (CHEMBL2188185) |
|---|
| Ki | >10000±n/a nM |
|---|
| Citation |  Dubost, E; Dumas, N; Fossey, C; Magnelli, R; Butt-Gueulle, S; Ballandonne, C; Caignard, DH; Dulin, F; Sopkova de-Oliveira Santos, J; Millet, P; Charnay, Y; Rault, S; Cailly, T; Fabis, F Synthesis and structure-affinity relationships of selective high-affinity 5-HT(4) receptor antagonists: application to the design of new potential single photon emission computed tomography tracers. J Med Chem55:9693-707 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 5A |
|---|
| Name: | 5-hydroxytryptamine receptor 5A |
|---|
| Synonyms: | 5-HT-5 | 5-HT-5A | 5-hydroxytryptamine receptor 5 (5-HT5) | 5-hydroxytryptamine receptor 5A (5-HT5A) | 5HT5A_HUMAN | HTR5A | Serotonin (5-HT) receptor | Serotonin receptor 5A |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40266.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P47898 |
|---|
| Residue: | 357 |
|---|
| Sequence: | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
|
|
|
|---|
| BDBM50399616 |
|---|
| n/a |
|---|
| Name | BDBM50399616 |
|---|
| Synonyms: | CHEMBL2181188 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25ClN2O |
|---|
| Mol. Mass. | 368.9 |
|---|
| SMILES | CCCN1CCC(COc2nc3c(Cl)cccc3c3ccccc23)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
