Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50401097 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_884446 (CHEMBL2212208) |
---|
IC50 | 3±n/a nM |
---|
Citation | Kaila, N; Huang, A; Moretto, A; Follows, B; Janz, K; Lowe, M; Thomason, J; Mansour, TS; Hubeau, C; Page, K; Morgan, P; Fish, S; Xu, X; Williams, C; Saiah, E Diazine indole acetic acids as potent, selective, and orally bioavailable antagonists of chemoattractant receptor homologous molecule expressed on Th2 cells (CRTH2) for the treatment of allergic inflammatory diseases. J Med Chem55:5088-109 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50401097 |
---|
n/a |
---|
Name | BDBM50401097 |
Synonyms: | CHEMBL2204469 |
Type | Small organic molecule |
Emp. Form. | C23H18F3N3O3 |
Mol. Mass. | 441.4025 |
SMILES | Cc1c(Cc2ccc(=O)n(Cc3ccc(F)cc3F)n2)c2cc(F)ccc2n1CC(O)=O |
Structure |
|