Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-2 |
---|
Ligand | BDBM50427000 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_939308 (CHEMBL2327273) |
---|
IC50 | 2700±n/a nM |
---|
Citation | Geurink, PP; van der Linden, WA; Mirabella, AC; Gallastegui, N; de Bruin, G; Blom, AE; Voges, MJ; Mock, ED; Florea, BI; van der Marel, GA; Driessen, C; van der Stelt, M; Groll, M; Overkleeft, HS; Kisselev, AF Incorporation of non-natural amino acids improves cell permeability and potency of specific inhibitors of proteasome trypsin-like sites. J Med Chem56:1262-75 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-2 |
---|
Name: | Proteasome subunit beta type-2 |
Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
Type: | PROTEIN |
Mol. Mass.: | 22837.53 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1294233 |
Residue: | 201 |
Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
BDBM50427000 |
---|
n/a |
---|
Name | BDBM50427000 |
Synonyms: | CHEMBL2326265 |
Type | Small organic molecule |
Emp. Form. | C32H45N7O5S |
Mol. Mass. | 639.809 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(N)cc1)NC(=O)[C@H](Cc1ccccc1)N=[N+]=[N-])\C=C\S(C)(=O)=O |r| |
Structure |
|