Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50438443 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_975943 (CHEMBL2415592) |
---|
IC50 | 5000±n/a nM |
---|
Citation | Hassan, GS; El-Messery, SM; Al-Omary, FA; Al-Rashood, ST; Shabayek, MI; Abulfadl, YS; Habib, el-SE; El-Hallouty, SM; Fayad, W; Mohamed, KM; El-Menshawi, BS; El-Subbagh, HI Nonclassical antifolates, part 4. 5-(2-aminothiazol-4-yl)-4-phenyl-4H-1,2,4-triazole-3-thiols as a new class of DHFR inhibitors: synthesis, biological evaluation and molecular modeling study. Eur J Med Chem66:135-45 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
Type: | Enzyme |
Mol. Mass.: | 21603.71 |
Organism: | Bos taurus (Cattle) |
Description: | P00376 |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
BDBM50438443 |
---|
n/a |
---|
Name | BDBM50438443 |
Synonyms: | CHEMBL2414364 |
Type | Small organic molecule |
Emp. Form. | C16H15N5O3S2 |
Mol. Mass. | 389.452 |
SMILES | COc1ccc(cc1)-n1c(n[nH]c1=S)-c1csc(n1)N(C(C)=O)C(C)=O |
Structure |
|