Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50016270 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1348915 (CHEMBL3271546) |
---|
Ki | 20573±n/a nM |
---|
Citation | Bai, S; Li, S; Xu, J; Peng, X; Sai, K; Chu, W; Tu, Z; Zeng, C; Mach, RH Synthesis and structure-activity relationship studies of conformationally flexible tetrahydroisoquinolinyl triazole carboxamide and triazole substituted benzamide analogues ass2 receptor ligands. J Med Chem57:4239-51 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50016270 |
---|
n/a |
---|
Name | BDBM50016270 |
Synonyms: | CHEMBL3262521 |
Type | Small organic molecule |
Emp. Form. | C26H33N5O4 |
Mol. Mass. | 479.5713 |
SMILES | COc1ccccc1Cn1cc(nn1)C(=O)NCCCCN1CCc2cc(OC)c(OC)cc2C1 |
Structure |
|