Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50019087 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1361427 (CHEMBL3294051) |
---|
EC50 | 16±n/a nM |
---|
Citation | Takano, R; Yoshida, M; Inoue, M; Honda, T; Nakashima, R; Matsumoto, K; Yano, T; Ogata, T; Watanabe, N; Toda, N Discovery of 3-aryl-3-ethoxypropanoic acids as orally active GPR40 agonists. Bioorg Med Chem Lett24:2949-53 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1_RAT | Ffar1 | G-protein coupled receptor 40 | Gpr40 |
Type: | PROTEIN |
Mol. Mass.: | 31848.38 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_1511162 |
Residue: | 300 |
Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLACSDLLLAITLP
LKAVEALASGVWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
CYSWGVCVAIWALVLCHLGLALGLEAPRGWVDNTTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVHSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLEGSWRKLGLITGAWSVVLNPLVTGYLGTGPGQGTICVTRTPRGTIQK
|
|
|
BDBM50019087 |
---|
n/a |
---|
Name | BDBM50019087 |
Synonyms: | CHEMBL3288348 |
Type | Small organic molecule |
Emp. Form. | C22H22N2O3 |
Mol. Mass. | 362.4217 |
SMILES | Cc1cccc(C)c1-c1cccc(COc2cnc(CCC(O)=O)cn2)c1 |
Structure |
|