| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50019107 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1361427 (CHEMBL3294051) |
|---|
| EC50 | 130±n/a nM |
|---|
| Citation |  Takano, R; Yoshida, M; Inoue, M; Honda, T; Nakashima, R; Matsumoto, K; Yano, T; Ogata, T; Watanabe, N; Toda, N Discovery of 3-aryl-3-ethoxypropanoic acids as orally active GPR40 agonists. Bioorg Med Chem Lett24:2949-53 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1_RAT | Ffar1 | G-protein coupled receptor 40 | Gpr40 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31848.38 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1511162 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLACSDLLLAITLP
LKAVEALASGVWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
CYSWGVCVAIWALVLCHLGLALGLEAPRGWVDNTTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVHSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLEGSWRKLGLITGAWSVVLNPLVTGYLGTGPGQGTICVTRTPRGTIQK
|
|
|
|---|
| BDBM50019107 |
|---|
| n/a |
|---|
| Name | BDBM50019107 |
|---|
| Synonyms: | CHEMBL3288359 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27NO4 |
|---|
| Mol. Mass. | 405.4862 |
|---|
| SMILES | CCOC(CC(O)=O)c1ccc(OCc2cccc(c2)-c2c(C)cccc2C)nc1 |
|---|
| Structure | 
|
|---|
Search and Browse
