Reaction Details |
| Report a problem with these data |
Target | Orexin/Hypocretin receptor type 1 |
---|
Ligand | BDBM106971 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1433180 (CHEMBL3387580) |
---|
Ki | 3600±n/a nM |
---|
Citation | Roecker, AJ; Reger, TS; Mattern, MC; Mercer, SP; Bergman, JM; Schreier, JD; Cube, RV; Cox, CD; Li, D; Lemaire, W; Bruno, JG; Harrell, CM; Garson, SL; Gotter, AL; Fox, SV; Stevens, J; Tannenbaum, PL; Prueksaritanont, T; Cabalu, TD; Cui, D; Stellabott, J; Hartman, GD; Young, SD; Winrow, CJ; Renger, JJ; Coleman, PJ Discovery of MK-3697: a selective orexin 2 receptor antagonist (2-SORA) for the treatment of insomnia. Bioorg Med Chem Lett24:4884-90 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Orexin/Hypocretin receptor type 1 |
---|
Name: | Orexin/Hypocretin receptor type 1 |
Synonyms: | HCRTR1 | Hypocretin receptor type 1 | OX1R_HUMAN | Orexin receptor type 1 | Orexin receptor type 1 (OR 1) | Orexin receptor type 1 (OR-1) | Orexin receptor type 1 (OX1) | Orexin receptor type 1 (OX1R) | Orexin receptor type 1 (OxR1) | Ox1r |
Type: | Protein |
Mol. Mass.: | 47554.50 |
Organism: | Homo sapiens (Human) |
Description: | O43613 |
Residue: | 425 |
Sequence: | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP
|
|
|
BDBM106971 |
---|
n/a |
---|
Name | BDBM106971 |
Synonyms: | US8592457, 7-5 |
Type | Small organic molecule |
Emp. Form. | C23H21N5O3S |
Mol. Mass. | 447.51 |
SMILES | COc1ccc(CNC(=O)c2cc(ncc2-c2nccs2)-c2cncc(C)c2)nc1OC |
Structure |
|