Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50067603 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1466205 (CHEMBL3405129) |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 150±n/a nM |
---|
Comments | extracted |
---|
Citation | Yang, ZH; Bai, XG; Zhou, L; Wang, JX; Liu, HT; Wang, YC Synthesis and biological evaluation of novel HIV-1 protease inhibitors using tertiary amine as P2-ligands. Bioorg Med Chem Lett25:1880-3 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50067603 |
---|
n/a |
---|
Name | BDBM50067603 |
Synonyms: | CHEMBL3400721 |
Type | Small organic molecule |
Emp. Form. | C34H46N4O7S |
Mol. Mass. | 654.817 |
SMILES | CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)CN(CC(=O)N(C)C)c1cccc(O)c1C)S(=O)(=O)c1ccc(CO)cc1 |r| |
Structure |
|