Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50095060 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1503356 (CHEMBL3590859) |
---|
Ki | 26±n/a nM |
---|
Citation | Barthel, C; Sorger, D; Deuther-Conrad, W; Scheunemann, M; Schweiger, S; Jäckel, P; Roghani, A; Steinbach, J; Schüürmann, G; Sabri, O; Brust, P; Wenzel, B New systematically modified vesamicol analogs and their affinity and selectivity for the vesicular acetylcholine transporter - A critical examination of the lead structure. Eur J Med Chem100:50-67 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50095060 |
---|
n/a |
---|
Name | BDBM50095060 |
Synonyms: | CHEMBL3589711 |
Type | Small organic molecule |
Emp. Form. | C23H29FN2O2 |
Mol. Mass. | 384.487 |
SMILES | O[C@@H]1CC[C@H](C[C@H]1N1CCC(CC1)c1ccncc1)OCc1ccc(F)cc1 |r| |
Structure |
|