| Reaction Details |
|---|
 | Report a problem with these data |
| Target | von Hippel-Lindau disease tumor suppressor |
|---|
| Ligand | BDBM50099146 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1459715 (CHEMBL3370433) |
|---|
| Kd | 10200±n/a nM |
|---|
| Citation |  Galdeano, C; Gadd, MS; Soares, P; Scaffidi, S; Van Molle, I; Birced, I; Hewitt, S; Dias, DM; Ciulli, A Structure-guided design and optimization of small molecules targeting the protein-protein interaction between the von Hippel-Lindau (VHL) E3 ubiquitin ligase and the hypoxia inducible factor (HIF) alpha subunit with in vitro nanomolar affinities. J Med Chem57:8657-63 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| von Hippel-Lindau disease tumor suppressor |
|---|
| Name: | von Hippel-Lindau disease tumor suppressor |
|---|
| Synonyms: | Protein G7 | VHL | VHL_HUMAN | Von Hippel-Lindau disease tumor suppressor | Von Hippel-Lindau disease tumor suppressor protein (VBC) | pVHL |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24136.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P40337 |
|---|
| Residue: | 213 |
|---|
| Sequence: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI
VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
|
|
|
|---|
| BDBM50099146 |
|---|
| n/a |
|---|
| Name | BDBM50099146 |
|---|
| Synonyms: | CHEMBL3344077 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H29N3O4 |
|---|
| Mol. Mass. | 399.4834 |
|---|
| SMILES | Cc1ncoc1-c1ccc(CNC(=O)[C@@H]2C[C@@H](O)CN2C(=O)CC(C)(C)C)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
