Reaction Details |
| Report a problem with these data |
Target | Alpha-synuclein |
---|
Ligand | BDBM50103934 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1505256 (CHEMBL3594881) |
---|
Ki | 13±n/a nM |
---|
Citation | Chu, W; Zhou, D; Gaba, V; Liu, J; Li, S; Peng, X; Xu, J; Dhavale, D; Bagchi, DP; d'Avignon, A; Shakerdge, NB; Bacskai, BJ; Tu, Z; Kotzbauer, PT; Mach, RH Design, Synthesis, and Characterization of 3-(Benzylidene)indolin-2-one Derivatives as Ligands fora-Synuclein Fibrils. J Med Chem58:6002-17 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Alpha-synuclein |
---|
Name: | Alpha-synuclein |
Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
Type: | Protein |
Mol. Mass.: | 14451.42 |
Organism: | Homo sapiens (Human) |
Description: | P37840 |
Residue: | 140 |
Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
BDBM50103934 |
---|
n/a |
---|
Name | BDBM50103934 |
Synonyms: | CHEMBL3593926 |
Type | Small organic molecule |
Emp. Form. | C25H20N2O4 |
Mol. Mass. | 412.4373 |
SMILES | COc1ccc(CN2C(=O)\C(=C/C=C/c3ccc(cc3)[N+]([O-])=O)c3ccccc23)cc1 |
Structure |
|